Loading...
Statistics
Advertisement

Hardtomatch.co.uk

Advertisement
Conversion Technology Metas Server
Hardtomatch.co.uk is hosted in United Kingdom / Gloucester . Hardtomatch.co.uk doesn't use HTTPS protocol. Number of used technologies: 4. First technologies: CSS, Html, Html5, Number of used javascripts: 0. Number of used analytics tools: 0. Its server type is: nginx/1.6.3.

Technologies in use by Hardtomatch.co.uk

Technology

Number of occurences: 4
  • CSS
  • Html
  • Html5
  • Javascript

Advertisement

Server Type

  • nginx/1.6.3

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Hardtomatch.co.uk

Missing HTTPS protocol.

    Meta - Hardtomatch.co.uk

    Number of occurences: 5
    • Name:
      Content:
    • Name: expires
      Content: NOW
    • Name: GOOGLEBOT
      Content: index, follow, all
    • Name: robots
      Content: index, follow, all
    • Name: viewport
      Content: width=device-width; initial-scale=1.0; maximum-scale=1.0; user-scalable=0;

    Server / Hosting

    • IP: 213.171.195.105
    • Latitude: 51.83
    • Longitude: -2.25
    • Country: United Kingdom
    • City: Gloucester

    Rname

    • ns3.livedns.co.uk
    • ns1.livedns.co.uk
    • ns2.livedns.co.uk

    Target

    • admin.hardtomatch.co.uk

    HTTP Header Response

    HTTP/1.1 200 OK Server: nginx/1.6.3 Date: Sat, 02 Jul 2016 22:17:55 GMT Content-Type: text/html Content-Length: 1358 Last-Modified: Wed, 02 Sep 2015 11:05:06 GMT ETag: "55e6d7e2-54e" Accept-Ranges: bytes X-Cache: MISS from s_xt50 X-Cache-Lookup: MISS from s_xt50:80 Via: 1.1 s_xt50 (squid/3.5.14) Connection: keep-alive

    DNS

    host: hardtomatch.co.uk
    1. class: IN
    2. ttl: 3600
    3. type: A
    4. ip: 213.171.195.105
    host: hardtomatch.co.uk
    1. class: IN
    2. ttl: 3600
    3. type: NS
    4. target: ns3.livedns.co.uk
    host: hardtomatch.co.uk
    1. class: IN
    2. ttl: 3600
    3. type: NS
    4. target: ns1.livedns.co.uk
    host: hardtomatch.co.uk
    1. class: IN
    2. ttl: 3600
    3. type: NS
    4. target: ns2.livedns.co.uk
    host: hardtomatch.co.uk
    1. class: IN
    2. ttl: 3600
    3. type: SOA
    4. mname: ns1.livedns.co.uk
    5. rname: admin.hardtomatch.co.uk
    6. serial: 1332925504
    7. refresh: 10800
    8. retry: 3600
    9. expire: 604800
    10. minimum-ttl: 3600

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.ardtomatch.co.uk, www.heardtomatch.co.uk, www.eardtomatch.co.uk, www.hdardtomatch.co.uk, www.dardtomatch.co.uk, www.hcardtomatch.co.uk, www.cardtomatch.co.uk, www.huardtomatch.co.uk, www.uardtomatch.co.uk, www.hjardtomatch.co.uk, www.jardtomatch.co.uk, www.hardtomatch.co.uk, www.ardtomatch.co.uk, www.hbardtomatch.co.uk, www.bardtomatch.co.uk, www.hgardtomatch.co.uk, www.gardtomatch.co.uk, www.hrdtomatch.co.uk, www.haordtomatch.co.uk, www.hordtomatch.co.uk, www.haprdtomatch.co.uk, www.hprdtomatch.co.uk, www.ha9rdtomatch.co.uk, www.h9rdtomatch.co.uk, www.hardtomatch.co.uk, www.hrdtomatch.co.uk, www.hairdtomatch.co.uk, www.hirdtomatch.co.uk, www.haurdtomatch.co.uk, www.hurdtomatch.co.uk, www.hadtomatch.co.uk, www.haridtomatch.co.uk, www.haidtomatch.co.uk, www.harodtomatch.co.uk, www.haodtomatch.co.uk, www.harldtomatch.co.uk, www.haldtomatch.co.uk, www.harldtomatch.co.uk, www.haldtomatch.co.uk, www.har.dtomatch.co.uk, www.ha.dtomatch.co.uk, www.hartomatch.co.uk, www.hardttomatch.co.uk, www.harttomatch.co.uk, www.hardgtomatch.co.uk, www.hargtomatch.co.uk, www.hardbtomatch.co.uk, www.harbtomatch.co.uk, www.hardxtomatch.co.uk, www.harxtomatch.co.uk, www.hardstomatch.co.uk, www.harstomatch.co.uk, www.hardftomatch.co.uk, www.harftomatch.co.uk, www.hardvtomatch.co.uk, www.harvtomatch.co.uk, www.hardytomatch.co.uk, www.harytomatch.co.uk, www.hardztomatch.co.uk, www.harztomatch.co.uk, www.hardatomatch.co.uk, www.haratomatch.co.uk, www.hardetomatch.co.uk, www.haretomatch.co.uk, www.hardrtomatch.co.uk, www.harrtomatch.co.uk, www.hardomatch.co.uk, www.hardtqomatch.co.uk, www.hardqomatch.co.uk, www.hardtaomatch.co.uk, www.hardaomatch.co.uk, www.hardt omatch.co.uk, www.hard omatch.co.uk, www.hardtwomatch.co.uk, www.hardwomatch.co.uk, www.hardteomatch.co.uk, www.hardeomatch.co.uk, www.hardtzomatch.co.uk, www.hardzomatch.co.uk, www.hardtxomatch.co.uk, www.hardxomatch.co.uk, www.hardtcomatch.co.uk, www.hardcomatch.co.uk, www.hardtmatch.co.uk, www.hardtobmatch.co.uk, www.hardtbmatch.co.uk, www.hardtohmatch.co.uk, www.hardthmatch.co.uk, www.hardtogmatch.co.uk, www.hardtgmatch.co.uk, www.hardtojmatch.co.uk, www.hardtjmatch.co.uk, www.hardtommatch.co.uk, www.hardtmmatch.co.uk, www.hardto match.co.uk, www.hardt match.co.uk, www.hardtovmatch.co.uk, www.hardtvmatch.co.uk, www.hardtoatch.co.uk, www.hardtompatch.co.uk, www.hardtopatch.co.uk, www.hardtomoatch.co.uk, www.hardtooatch.co.uk, www.hardtomiatch.co.uk, www.hardtoiatch.co.uk, www.hardtomkatch.co.uk, www.hardtokatch.co.uk, www.hardtom.atch.co.uk, www.hardto.atch.co.uk, www.hardtomuatch.co.uk, www.hardtouatch.co.uk, www.hardtomjatch.co.uk, www.hardtojatch.co.uk, www.hardtomnatch.co.uk, www.hardtonatch.co.uk, www.hardtom-atch.co.uk, www.hardto-atch.co.uk, www.hardtomtch.co.uk, www.hardtomaotch.co.uk, www.hardtomotch.co.uk, www.hardtomaptch.co.uk, www.hardtomptch.co.uk, www.hardtoma9tch.co.uk, www.hardtom9tch.co.uk, www.hardtomatch.co.uk, www.hardtomtch.co.uk, www.hardtomaitch.co.uk, www.hardtomitch.co.uk, www.hardtomautch.co.uk, www.hardtomutch.co.uk, www.hardtomach.co.uk, www.hardtomatqch.co.uk, www.hardtomaqch.co.uk, www.hardtomatach.co.uk, www.hardtomaach.co.uk, www.hardtomat ch.co.uk, www.hardtoma ch.co.uk, www.hardtomatwch.co.uk, www.hardtomawch.co.uk, www.hardtomatech.co.uk, www.hardtomaech.co.uk, www.hardtomatzch.co.uk, www.hardtomazch.co.uk, www.hardtomatxch.co.uk, www.hardtomaxch.co.uk, www.hardtomatcch.co.uk, www.hardtomacch.co.uk, www.hardtomath.co.uk, www.hardtomatcdh.co.uk, www.hardtomatdh.co.uk, www.hardtomatcrh.co.uk, www.hardtomatrh.co.uk, www.hardtomatcth.co.uk, www.hardtomatth.co.uk, www.hardtomatcvh.co.uk, www.hardtomatvh.co.uk, www.hardtomatcfh.co.uk, www.hardtomatfh.co.uk, www.hardtomatcgh.co.uk, www.hardtomatgh.co.uk, www.hardtomatchh.co.uk, www.hardtomathh.co.uk, www.hardtomatcnh.co.uk, www.hardtomatnh.co.uk, www.hardtomatcmh.co.uk, www.hardtomatmh.co.uk, www.hardtomatcjh.co.uk, www.hardtomatjh.co.uk,

    Other websites we recently analyzed

    1. thodyonline.com
      United Kingdom - 81.21.76.62
      Server software: Apache/2.2.3 (CentOS)
      Technology: CSS, Html, Javascript, Php
      Number of Javascript: 1
      Number of meta tags: 1
    2. RPM Staffing Professionals, Inc.
      United States - 66.76.61.123
      Server software: Microsoft-IIS/7.5
      Technology: CSS, Html, Javascript, jQuery Cookie
      Number of Javascript: 8
    3. Camperplaatsen - Drive-In Camperpark Ouddorp aan Zee
      Camperplaatsen aan zee, vlakbij de Brouwersdam! Een uniek park met veel faciliteiten en is het gehele jaar geopend!
      Netherlands - 84.38.227.121
      G Analytics ID: UA-50480683-1
      Server software: Apache/2.2.3 (CentOS)
      Technology: CSS, Html, Javascript, Google Analytics
      Number of Javascript: 9
      Number of meta tags: 4
    4. ## Hidráulica Vale do Aço Service ##
      Site da Hidráulica Vale do Aço service
      Curitiba (Brazil) - 177.12.174.104
      Server software: Apache
      Technology: CSS, Php
      Number of meta tags: 18
    5. Mirador Aldaya
      Mountain View (United States) - 216.58.208.33
      Server software: GSE
      Technology: CSS, Html, Html5, Iframe, Javascript, Php, Schema.org, SVG, Wordpress, Add This, Google +1 Button
      Number of Javascript: 3
      Number of meta tags: 3
    6. Mijn Talent
      Netherlands - 109.71.51.117
      Server software: Apache/2.4.18 (Unix) OpenSSL/1.0.1e-fips mod_bwlimited/1.4 mod_fcgid/2.3.9
      Technology: CSS, Google Font API, Html, Javascript
      Number of Javascript: 3
      Number of meta tags: 2
    7. smallkitchenappliancesreviews.com
      Scottsdale (United States) - 184.168.221.104
      Server software: Microsoft-IIS/7.5
      Technology: Html
    8. Welcome to www.rolandkessel.nl
      www.rolandkessel.nl
      Netherlands - 83.96.159.15
      Server software: Apache/2
      Technology: CSS, Html, Javascript, Php
      Number of Javascript: 6
      Number of meta tags: 5
    9. performancecarsales.co.uk
      United Kingdom - 81.21.76.62
      Server software: Apache/2.2.3 (CentOS)
      Technology: CSS, Html, Javascript, Php
      Number of Javascript: 1
      Number of meta tags: 1
    10. Bible Sayings of the Fathers - sayings of moses, sayings of abraham, sayings of Isaach, sayings of Jacob
      Scottsdale (United States) - 23.229.188.67
      Server software: Apache
      Technology: CSS, Html
      Number of meta tags: 1

    Check Other Websites